General Information

  • ID:  hor006735
  • Uniprot ID:  P45883
  • Protein name:  Acyl-CoA-binding protein homolog
  • Gene name:  NA
  • Organism:  Pelophylax ridibundus (Marsh frog) (Rana ridibunda)
  • Family:  ACBP family
  • Source:  animal
  • Expression:  Brain. Is selectively expressed in glial cells.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Pelophylax (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0000062 fatty-acyl-CoA binding; GO:0008289 lipid binding
  • GO BP:  NA
  • GO CC:  GO:0005783 endoplasmic reticulum; GO:0005794 Golgi apparatus

Sequence Information

  • Sequence:  SPQADFDKAAGDVKKLKTKPTDDELKELYGLYKQSTVGDINIECPGMLDLKGKAKWDAWNLKKGLSKEDAMSAYVSKAHELIEKYGL
  • Length:  87
  • Propeptide:  MSPQADFDKAAGDVKKLKTKPTDDELKELYGLYKQSTVGDINIECPGMLDLKGKAKWDAWNLKKGLSKEDAMSAYVSKAHELIEKYGL
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May play important functions in the control of brain and pituitary activities. May regulate GABA neurotransmission through a paracrine and/or autocrine mechanism. May not bind acyl-CoA esters.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P45883-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006735_AF2.pdbhor006735_ESM.pdb

Physical Information

Mass: 1121129 Formula: C433H690N110O134S3
Absent amino acids: R Common amino acids: K
pI: 7.35 Basic residues: 16
Polar residues: 22 Hydrophobic residues: 27
Hydrophobicity: -70.46 Boman Index: -14612
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 77.47
Instability Index: 4171.26 Extinction Coefficient cystines: 16960
Absorbance 280nm: 197.21

Literature

  • PubMed ID:  8041717
  • Title:  Frog diazepam-binding inhibitor: peptide sequence, cDNA cloning, and expression in the brain.
  • PubMed ID:  1341880
  • Title:  Distribution and characterization of endozepine-like immunoreactivity in the central nervous system of the frog Rana ridibunda.